PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15316_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 259aa    MW: 29168.7 Da    PI: 10.175
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15316_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.2e-171360148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd ll ++v+++G g W+ ++ + g++R++k+c++rw++yl
  cra_locus_15316_iso_1_len_800_ver_3 13 KGAWTEEEDILLRKCVEKYGEGKWHQVPFKAGLNRCRKSCRLRWLNYL 60
                                         79********************************************97 PP

2Myb_DNA-binding51.91.8e-1666111148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++  +Ed+l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_15316_iso_1_len_800_ver_3  66 RGKFNSDEDDLILRLHKLLGNR-WSLIAGRLP-GRTANDIKNYWNSHL 111
                                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.697864IPR017930Myb domain
SMARTSM007176.0E-141262IPR001005SANT/Myb domain
SuperFamilySSF466898.8E-3012107IPR009057Homeodomain-like
PfamPF002498.9E-161360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-231467IPR009057Homeodomain-like
CDDcd001676.38E-111560No hitNo description
SMARTSM007175.3E-1565113IPR001005SANT/Myb domain
PROSITE profilePS5129420.41765115IPR017930Myb domain
PfamPF002496.0E-1566111IPR001005SANT/Myb domain
CDDcd001675.29E-1168111No hitNo description
Gene3DG3DSA:1.10.10.607.2E-2568115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
XGSSGSAAVV LRKGAWTEEE DILLRKCVEK YGEGKWHQVP FKAGLNRCRK SCRLRWLNYL  60
RPNINRGKFN SDEDDLILRL HKLLGNRWSL IAGRLPGRTA NDIKNYWNSH LQKKLNGSSK  120
NKNKKNNKSQ KIKKAMITNN NIIKPQPRTF SKNAPWLRAK QVIHNPSPAA AQDSAAPKSQ  180
SMAAQDSADM MTWLDNLLND EQIISNDQGA IWSFNGGSSS EINPGRDQNE DILINQENDL  240
LDFCIDADIW AISSSPANI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-24101151105C-Myb DNA-Binding Domain
1mse_C3e-24101151105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274992.24e-76PREDICTED: transcription factor MYB90
SwissprotQ9FNV92e-64MY113_ARATH; Transcription factor MYB113
TrEMBLB8YPF84e-76B8YPF8_VITVI; R2R3 MYBA6 transcription factor splice variant 1
STRINGVIT_14s0006g01290.t011e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154